- PTRHD1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-93543
- PTRHD1
- Human
- Unconjugated
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: GRMRKVVLEA PDETTLKELA ETLQQKNIDH MLWLEQPENI ATCIALRPYP KEEVGQYLKK FRLFK
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- peptidyl-tRNA hydrolase domain containing 1
- C2orf79
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- DNA replication Transcription Translation and Splicing
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
Sequence
GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
Specifications/Features
Available conjugates: Unconjugated